SPTAN1 antibody (70R-2207)

Rabbit polyclonal SPTAN1 antibody

Synonyms Polyclonal SPTAN1 antibody, Anti-SPTAN1 antibody, SPTAN-1, SPTAN 1, SPTAN1, SPTAN 1 antibody, Alpha Fodrin antibody, FLJ44613 antibody, (ALPHA)II-SPECTRIN antibody, SPTAN-1 antibody, Spectrin Alpha Non-Erythrocytic 1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SPTAN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
Assay Information SPTAN1 Blocking Peptide, catalog no. 33R-5860, is also available for use as a blocking control in assays to test for specificity of this SPTAN1 antibody


Western Blot analysis using SPTAN1 antibody (70R-2207)

SPTAN1 antibody (70R-2207) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 272 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPTAN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SPTAN1 antibody (70R-2207) | SPTAN1 antibody (70R-2207) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £272.51
Size: 50 ug
View Our Distributors