SRP68 antibody (70R-4641)

Rabbit polyclonal SRP68 antibody raised against the N terminal of SRP68

Synonyms Polyclonal SRP68 antibody, Anti-SRP68 antibody, SRP-68 antibody, SRP68, SRP-68, Signal Recognition Particle 68Kda antibody, SRP 68, SRP 68 antibody
Specificity SRP68 antibody was raised against the N terminal of SRP68
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen SRP68 antibody was raised using the N terminal of SRP68 corresponding to a region with amino acids EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRG
Assay Information SRP68 Blocking Peptide, catalog no. 33R-2378, is also available for use as a blocking control in assays to test for specificity of this SRP68 antibody


Western Blot analysis using SRP68 antibody (70R-4641)

SRP68 antibody (70R-4641) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SRP68 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The signal recognition particle (SRP) is a ribonucleoprotein complex that transports secreted and membrane proteins to the endoplasmic reticulum for processing. The complex includes a 7S RNA and six protein subunits. SRP68 is the 68kDa component of the SRP.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SRP68 antibody (70R-4641) | SRP68 antibody (70R-4641) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors