SRR antibody (70R-3983)

Rabbit polyclonal SRR antibody raised against the middle region of SRR

Synonyms Polyclonal SRR antibody, Anti-SRR antibody, Serine Racemase antibody, ILV1 antibody, ISO1 antibody
Specificity SRR antibody was raised against the middle region of SRR
Cross Reactivity Human
Applications WB
Immunogen SRR antibody was raised using the middle region of SRR corresponding to a region with amino acids GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ
Assay Information SRR Blocking Peptide, catalog no. 33R-3639, is also available for use as a blocking control in assays to test for specificity of this SRR antibody


Western Blot analysis using SRR antibody (70R-3983)

SRR antibody (70R-3983) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SRR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SRR catalyzes the synthesis of D-serine from L-serine.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SRR antibody (70R-3983) | SRR antibody (70R-3983) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors