SS18L1 antibody (70R-3569)

Rabbit polyclonal SS18L1 antibody raised against the middle region of SS18L1

Synonyms Polyclonal SS18L1 antibody, Anti-SS18L1 antibody, MGC78386 antibody, SSL1 18, SS18L1, MGC26711 antibody, SSL1 18 antibody, KIAA0693 antibody, SSL1-18, SSL1-18 antibody, LP2261 antibody, CREST antibody, Synovial Sarcoma Translocation Gene On Chromosome 18-Like 1 antibody
Specificity SS18L1 antibody was raised against the middle region of SS18L1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SS18L1 antibody was raised using the middle region of SS18L1 corresponding to a region with amino acids EYYGEQYSHSQGAAEPMGQQYYPDGHGDYAYQQSSYTEQSYDRSFEESTQ
Assay Information SS18L1 Blocking Peptide, catalog no. 33R-2833, is also available for use as a blocking control in assays to test for specificity of this SS18L1 antibody

Images

Western Blot analysis using SS18L1 antibody (70R-3569)

SS18L1 antibody (70R-3569) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SS18L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X;18)(p11.2;q11.2), in which the 5-prime end of the SS18 gene is fused in-frame to the 3-prime end of the SSX1, SSX2, or SSX4 gene. The SS18L1 gene is homologous to SS18.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SS18L1 antibody (70R-3569) | SS18L1 antibody (70R-3569) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors