ST3GAL3 antibody (70R-1833)

Rabbit polyclonal ST3GAL3 antibody raised against the C terminal of ST3GAL3

Synonyms Polyclonal ST3GAL3 antibody, Anti-ST3GAL3 antibody, SIAT6 antibody, STGAL 3, STGAL-3 antibody, St3 Beta-Galactoside Alpha-23-Sialyltransferase 3 antibody, STGAL-3, ST3GalIII antibody, ST3GALII antibody, ST3N antibody, STGAL 3 antibody, ST3GAL3
Specificity ST3GAL3 antibody was raised against the C terminal of ST3GAL3
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen ST3GAL3 antibody was raised using the C terminal of ST3GAL3 corresponding to a region with amino acids GFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITD
Assay Information ST3GAL3 Blocking Peptide, catalog no. 33R-3259, is also available for use as a blocking control in assays to test for specificity of this ST3GAL3 antibody


Western Blot analysis using ST3GAL3 antibody (70R-1833)

ST3GAL3 antibody (70R-1833) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ST3GAL3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ST3GAL3 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL3 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ST3GAL3 antibody (70R-1833) | ST3GAL3 antibody (70R-1833) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors