ST6GALNAC5 antibody (70R-1903)

Rabbit polyclonal ST6GALNAC5 antibody raised against the middle region of ST6GALNAC5

Synonyms Polyclonal ST6GALNAC5 antibody, Anti-ST6GALNAC5 antibody, SIAT7E antibody, MGC3184 antibody, ST6GALNAC5, ST6GalNAcV antibody, STGALNAC5-6, STGALNAC5 6 antibody, STGALNAC5-6 antibody, STGALNAC5 6, St6 -N-Acetylgalactosaminide Alpha-26-Sialyltransferase 5 antibody
Specificity ST6GALNAC5 antibody was raised against the middle region of ST6GALNAC5
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen ST6GALNAC5 antibody was raised using the middle region of ST6GALNAC5 corresponding to a region with amino acids AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV
Assay Information ST6GALNAC5 Blocking Peptide, catalog no. 33R-1167, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC5 antibody


Western Blot analysis using ST6GALNAC5 antibody (70R-1903)

ST6GALNAC5 antibody (70R-1903) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ST6GALNAC5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ST6GALNAC5 antibody (70R-1903) | ST6GALNAC5 antibody (70R-1903) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors