STATH antibody (70R-5453)

Rabbit polyclonal STATH antibody raised against the middle region of STATH

Synonyms Polyclonal STATH antibody, Anti-STATH antibody, Statherin antibody, STR antibody
Specificity STATH antibody was raised against the middle region of STATH
Cross Reactivity Human
Applications WB
Immunogen STATH antibody was raised using the middle region of STATH corresponding to a region with amino acids MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYP
Assay Information STATH Blocking Peptide, catalog no. 33R-6136, is also available for use as a blocking control in assays to test for specificity of this STATH antibody

Images

Western Blot analysis using STATH antibody (70R-5453)

STATH antibody (70R-5453) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 7 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STATH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance STATH is a salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using STATH antibody (70R-5453) | STATH antibody (70R-5453) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors