STAU1 antibody (70R-4913)

Rabbit polyclonal STAU1 antibody

Synonyms Polyclonal STAU1 antibody, Anti-STAU1 antibody, STAU 1 antibody, STAU-1, STAU 1, Staufen Rna Binding Protein Homolog 1 antibody, STAU antibody, STAU1, FLJ25010 antibody, STAU-1 antibody
Cross Reactivity Human
Applications WB
Immunogen STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSTTSSLPSENAGRPIQNSALPSASITSTSAAAESITPTVELNALCMKLG
Assay Information STAU1 Blocking Peptide, catalog no. 33R-7376, is also available for use as a blocking control in assays to test for specificity of this STAU1 antibody


Western Blot analysis using STAU1 antibody (70R-4913)

STAU1 antibody (70R-4913) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STAU1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using STAU1 antibody (70R-4913) | STAU1 antibody (70R-4913) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors