STK32A antibody (70R-3604)

Rabbit polyclonal STK32A antibody raised against the N terminal of STK32A

Synonyms Polyclonal STK32A antibody, Anti-STK32A antibody, STKA 32, STKA-32, Serine/Threonine Kinase 32A antibody, STKA 32 antibody, MGC22688 antibody, STK32A, STKA-32 antibody, YANK1 antibody
Specificity STK32A antibody was raised against the N terminal of STK32A
Cross Reactivity Human
Applications WB
Immunogen STK32A antibody was raised using the N terminal of STK32A corresponding to a region with amino acids GANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAM
Assay Information STK32A Blocking Peptide, catalog no. 33R-3165, is also available for use as a blocking control in assays to test for specificity of this STK32A antibody


Western Blot analysis using STK32A antibody (70R-3604)

STK32A antibody (70R-3604) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STK32A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance STK32A belongs to the protein kinase superfamily, Ser/Thr protein kinase family. It contains 1 protein kinase domain. The function of the STK32A protein remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using STK32A antibody (70R-3604) | STK32A antibody (70R-3604) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors