STK38L antibody (70R-4530)

Rabbit polyclonal STK38L antibody raised against the middle region of STK38L

Synonyms Polyclonal STK38L antibody, Anti-STK38L antibody, STKL-38 antibody, STKL 38, NDR2 antibody, STKL-38, KIAA0965 antibody, Serine/Threonine Kinase 38 Like antibody, STKL 38 antibody, STK38L
Specificity STK38L antibody was raised against the middle region of STK38L
Cross Reactivity Human
Applications WB
Immunogen STK38L antibody was raised using the middle region of STK38L corresponding to a region with amino acids PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK
Assay Information STK38L Blocking Peptide, catalog no. 33R-6952, is also available for use as a blocking control in assays to test for specificity of this STK38L antibody

Images

Western Blot analysis using STK38L antibody (70R-4530)

STK38L antibody (70R-4530) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STK38L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance STK38L is involved in the regulation of structural processes in differentiating and mature neuronal cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using STK38L antibody (70R-4530) | STK38L antibody (70R-4530) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors