STRAP antibody (70R-1056)

Rabbit polyclonal STRAP antibody raised against the C terminal of STRAP

Synonyms Polyclonal STRAP antibody, Anti-STRAP antibody, UNRIP antibody, MAWD antibody, PT-WD antibody, Serine/Threonine Kinase Receptor Associated Protein antibody
Specificity STRAP antibody was raised against the C terminal of STRAP
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen STRAP antibody was raised using the C terminal of STRAP corresponding to a region with amino acids ASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEEL
Assay Information STRAP Blocking Peptide, catalog no. 33R-1507, is also available for use as a blocking control in assays to test for specificity of this STRAP antibody


Immunohistochemical staining using STRAP antibody (70R-1056)

STRAP antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of STRAP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using STRAP antibody (70R-1056) | STRAP antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using STRAP antibody (70R-1056) | STRAP antibody (70R-1056) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors