SULF2 antibody (70R-1881)

Rabbit polyclonal SULF2 antibody raised against the C terminal of SULF2

Synonyms Polyclonal SULF2 antibody, Anti-SULF2 antibody, FLJ90554 antibody, KIAA1247 antibody, SULF-2, HSULF-2 antibody, Sulfatase 2 antibody, SULF 2 antibody, SULF 2, SULF2, DKFZp313E091 antibody, SULF-2 antibody, MGC126411 antibody
Specificity SULF2 antibody was raised against the C terminal of SULF2
Cross Reactivity Human
Applications IHC, WB
Immunogen SULF2 antibody was raised using the C terminal of SULF2 corresponding to a region with amino acids DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKW
Assay Information SULF2 Blocking Peptide, catalog no. 33R-2218, is also available for use as a blocking control in assays to test for specificity of this SULF2 antibody


Immunohistochemical staining using SULF2 antibody (70R-1881)

SULF2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SULF2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SULF2 antibody (70R-1881) | SULF2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SULF2 antibody (70R-1881) | SULF2 antibody (70R-1881) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using SULF2 antibody (70R-1881) | SULF2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors