SULT1E1 antibody (70R-4473)

Rabbit polyclonal SULT1E1 antibody raised against the middle region of SULT1E1

Synonyms Polyclonal SULT1E1 antibody, Anti-SULT1E1 antibody, EST antibody, STE antibody, SULT1E1 10, SULT1E1-10, SULT1E1 10 antibody, SULT1E1, SULT1E1-10 antibody, Sulfotransferase Family 1E Estrogen-Preferring Member 1 antibody, EST-1 antibody, MGC34459 antibody
Specificity SULT1E1 antibody was raised against the middle region of SULT1E1
Cross Reactivity Human
Applications WB
Immunogen SULT1E1 antibody was raised using the middle region of SULT1E1 corresponding to a region with amino acids LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY
Assay Information SULT1E1 Blocking Peptide, catalog no. 33R-5214, is also available for use as a blocking control in assays to test for specificity of this SULT1E1 antibody


Western Blot analysis using SULT1E1 antibody (70R-4473)

SULT1E1 antibody (70R-4473) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SULT1E1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SULT1E1 antibody (70R-4473) | SULT1E1 antibody (70R-4473) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors