SUNC1 antibody (70R-3732)

Rabbit polyclonal SUNC1 antibody raised against the C terminal of SUNC1

Synonyms Polyclonal SUNC1 antibody, Anti-SUNC1 antibody, SUNC1, Sad1 And Unc84 Domain Containing 1 antibody, SUNC-1 antibody, MGC33329 antibody, SUNC-1, SUNC 1, SUNC 1 antibody
Specificity SUNC1 antibody was raised against the C terminal of SUNC1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SUNC1 antibody was raised using the C terminal of SUNC1 corresponding to a region with amino acids IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL
Assay Information SUNC1 Blocking Peptide, catalog no. 33R-4024, is also available for use as a blocking control in assays to test for specificity of this SUNC1 antibody


Western Blot analysis using SUNC1 antibody (70R-3732)

SUNC1 antibody (70R-3732) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SUNC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SUNC1 is a single-pass membrane protein. It contains 1 Unc84 (SUN) domain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SUNC1 antibody (70R-3732) | SUNC1 antibody (70R-3732) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors