SUV39H2 antibody (70R-4560)

Rabbit polyclonal SUV39H2 antibody

Synonyms Polyclonal SUV39H2 antibody, Anti-SUV39H2 antibody, SUVH2 39 antibody, SUVH2 39, FLJ23414 antibody, KMT1B antibody, SUV39H2, SUVH2-39, SUVH2-39 antibody, Suppressor Of Variegation 3-9 Homolog 2 antibody
Cross Reactivity Human
Applications WB
Immunogen SUV39H2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRT
Assay Information SUV39H2 Blocking Peptide, catalog no. 33R-4870, is also available for use as a blocking control in assays to test for specificity of this SUV39H2 antibody


Western Blot analysis using SUV39H2 antibody (70R-4560)

SUV39H2 antibody (70R-4560) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SUV39H2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SUV39H2 is a histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3 using monomethylated H3 'Lys-9' as substrate. H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Mainly functions in heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin at pericentric and telomere regions. H3 'Lys-9' trimethylation is also required to direct DNA methylation at pericentric repeats.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SUV39H2 antibody (70R-4560) | SUV39H2 antibody (70R-4560) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors