SWAP70 antibody (70R-1041)

Rabbit polyclonal SWAP70 antibody raised against the N terminal of SWAP70

Synonyms Polyclonal SWAP70 antibody, Anti-SWAP70 antibody, SWAP 70, HSPC321 antibody, KIAA0640 antibody, SWAP 70 antibody, Switch associated protein 70 antibody, FLJ39540 antibody, SWAP-70 antibody, SWAP-70, SWAP70, SWAP-70 antibody, Swap-70 Protein antibody
Specificity SWAP70 antibody was raised against the N terminal of SWAP70
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SWAP70 antibody was raised using the N terminal of SWAP70 corresponding to a region with amino acids ALEEHFRDDDEGPVSNQGYMPYLNRFILEKVQDNFDKIEFNRMCWTLCVK
Assay Information SWAP70 Blocking Peptide, catalog no. 33R-1326, is also available for use as a blocking control in assays to test for specificity of this SWAP70 antibody

Images

Western Blot analysis using SWAP70 antibody (70R-1041)

SWAP70 antibody (70R-1041) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SWAP70 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which, independently of RAS, transduces signals from tyrosine kinase receptors to RAC. SWAP70 also mediates signaling of membrane ruffling. It regulates the actin cytoskeleton as an effector or adapter protein in response to agonist stimulated phosphatidylinositol (3,4)-bisphosphate production and cell protrusion.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SWAP70 antibody (70R-1041) | SWAP70 antibody (70R-1041) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors