SYCP1 antibody (70R-5607)

Rabbit polyclonal SYCP1 antibody raised against the N terminal of SYCP1

Synonyms Polyclonal SYCP1 antibody, Anti-SYCP1 antibody, SYCP1, SYCP-1 antibody, SYCP-1, SYCP 1 antibody, MGC104417 antibody, Synaptonemal Complex Protein 1 antibody, SYCP 1, HOM-TES-14 antibody, SCP1 antibody
Specificity SYCP1 antibody was raised against the N terminal of SYCP1
Cross Reactivity Human
Applications WB
Immunogen SYCP1 antibody was raised using the N terminal of SYCP1 corresponding to a region with amino acids NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV
Assay Information SYCP1 Blocking Peptide, catalog no. 33R-6689, is also available for use as a blocking control in assays to test for specificity of this SYCP1 antibody


Western Blot analysis using SYCP1 antibody (70R-5607)

SYCP1 antibody (70R-5607) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 107 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SYCP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SYCP1 is a major component of the transverse filaments of synaptonemal complexes (SCS), which is formed between homologous chromosomes during meiotic prophase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SYCP1 antibody (70R-5607) | SYCP1 antibody (70R-5607) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors