SYNCRIP antibody (70R-1335)

Rabbit polyclonal SYNCRIP antibody raised against the middle region of SYNCRIP

Synonyms Polyclonal SYNCRIP antibody, Anti-SYNCRIP antibody, RP1-3J17.2 antibody, NSAP1 antibody, GRY-RBP antibody, dJ3J17.2 antibody, Synaptotagmin Binding Cytoplasmic Rna Interacting Protein antibody, pp68 antibody
Specificity SYNCRIP antibody was raised against the middle region of SYNCRIP
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen SYNCRIP antibody was raised using the middle region of SYNCRIP corresponding to a region with amino acids IEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGG
Assay Information SYNCRIP Blocking Peptide, catalog no. 33R-3941, is also available for use as a blocking control in assays to test for specificity of this SYNCRIP antibody

Images

Western Blot analysis using SYNCRIP antibody (70R-1335)

SYNCRIP antibody (70R-1335) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SYNCRIP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. SYNCRIP may be involved in translationally coupled mRNA turnover. It implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. It interacts in vitro preferentially with poly(A) and poly(U) RNA sequences.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SYNCRIP antibody (70R-1335) | SYNCRIP antibody (70R-1335) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors