TARBP2 antibody (70R-1374)

Rabbit polyclonal TARBP2 antibody

Synonyms Polyclonal TARBP2 antibody, Anti-TARBP2 antibody, Hiv-1 Rna Binding Protein 2 antibody, TARBP 2 antibody, TARBP-2, Tar RNA binding protein 2 antibody, TARBP 2, TARBP2, TARBP-2 antibody
Cross Reactivity Human, Mouse, Rat, ZebraFish
Applications WB
Immunogen TARBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCT
Assay Information TARBP2 Blocking Peptide, catalog no. 33R-1405, is also available for use as a blocking control in assays to test for specificity of this TARBP2 antibody


Western Blot analysis using TARBP2 antibody (70R-1374)

TARBP2 antibody (70R-1374) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 8 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TARBP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARBP2 binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TARBP2 antibody (70R-1374) | TARBP2 antibody (70R-1374) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors