TARS antibody (70R-1227)

Rabbit polyclonal TARS antibody raised against the N terminal of TARS

Synonyms Polyclonal TARS antibody, Anti-TARS antibody, ThrRS antibody, Threonyl-tRNA Synthetase antibody, MGC9344 antibody
Specificity TARS antibody was raised against the N terminal of TARS
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen TARS antibody was raised using the N terminal of TARS corresponding to a region with amino acids PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT
Assay Information TARS Blocking Peptide, catalog no. 33R-7067, is also available for use as a blocking control in assays to test for specificity of this TARS antibody

Images

Western Blot analysis using TARS antibody (70R-1227)

TARS antibody (70R-1227) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 78 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TARS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Threonyl-tRNA synthetase belongs to the class-II aminoacyl-tRNA synthetase family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TARS antibody (70R-1227) | TARS antibody (70R-1227) used at 5 ug/ml to detect target protein.
  • Immunohistochemical staining using TARS antibody (70R-1227) | TARS antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of fundic gland (arrows) in Human Stomach. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors