TBC1D13 antibody (70R-4389)

Rabbit polyclonal TBC1D13 antibody raised against the middle region of TBC1D13

Synonyms Polyclonal TBC1D13 antibody, Anti-TBC1D13 antibody, RP11-545E17.5 antibody, TBC 1, TBC-1 antibody, TBC 1 antibody, TBC1, FLJ10743 antibody, TBC-1, Tbc1 Domain Family Member 13 antibody
Specificity TBC1D13 antibody was raised against the middle region of TBC1D13
Cross Reactivity Human, Mouse
Applications WB
Immunogen TBC1D13 antibody was raised using the middle region of TBC1D13 corresponding to a region with amino acids FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS
Assay Information TBC1D13 Blocking Peptide, catalog no. 33R-2969, is also available for use as a blocking control in assays to test for specificity of this TBC1D13 antibody

Images

Western Blot analysis using TBC1D13 antibody (70R-4389)

TBC1D13 antibody (70R-4389) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TBC1D13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TBC1D13 may act as a GTPase-activating protein for Rab family proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TBC1D13 antibody (70R-4389) | TBC1D13 antibody (70R-4389) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors