TBC1D25 antibody (70R-4321)

Rabbit polyclonal TBC1D25 antibody raised against the N terminal of TBC1D25

Synonyms Polyclonal TBC1D25 antibody, Anti-TBC1D25 antibody, MGC126868 antibody, TBC 1, TBC 1 antibody, TBC-1, MGC149731 antibody, MG81 antibody, TBC1, OATL1 antibody, MGC149732 antibody, MGC126866 antibody, TBC-1 antibody, Tbc1 Domain Family Member 25 antibody
Specificity TBC1D25 antibody was raised against the N terminal of TBC1D25
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TBC1D25 antibody was raised using the N terminal of TBC1D25 corresponding to a region with amino acids KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG
Assay Information TBC1D25 Blocking Peptide, catalog no. 33R-4721, is also available for use as a blocking control in assays to test for specificity of this TBC1D25 antibody

Images

Western Blot analysis using TBC1D25 antibody (70R-4321)

TBC1D25 antibody (70R-4321) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TBC1D25 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein with a TBC domain and may function as a Rab GTPase activating protein. This gene was previously known as ornithine aminotransferase-like 1, but has no similarity to ornithine aminotransferase.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TBC1D25 antibody (70R-4321) | TBC1D25 antibody (70R-4321) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors