TC2N antibody (70R-3749)

Rabbit polyclonal TC2N antibody raised against the middle region of TC2N

Synonyms Polyclonal TC2N antibody, Anti-TC2N antibody, TCN-2, FLJ36557 antibody, TCN-2 antibody, Tac2-N antibody, MTAC2D1 antibody, C2CD1 antibody, Tandem C2 Domains Nuclear antibody, TCN 2, C14orf47 antibody, TC2N, TCN 2 antibody
Specificity TC2N antibody was raised against the middle region of TC2N
Cross Reactivity Human,Mouse
Applications WB
Immunogen TC2N antibody was raised using the middle region of TC2N corresponding to a region with amino acids SWPSSYGDTPTVSIKGILTLPKPVHFKSSAKEGSNAIEFMETFVFAIKLQ
Assay Information TC2N Blocking Peptide, catalog no. 33R-8943, is also available for use as a blocking control in assays to test for specificity of this TC2N antibody


Western Blot analysis using TC2N antibody (70R-3749)

TC2N antibody (70R-3749) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TC2N antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of TC2N is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TC2N antibody (70R-3749) | TC2N antibody (70R-3749) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors