TCP10L antibody (70R-1022)

Rabbit polyclonal TCP10L antibody

Synonyms Polyclonal TCP10L antibody, Anti-TCP10L antibody, TCP10A-2 antibody, TCP10, TCP-10, T-Complex 10 antibody, TCP 10 antibody, TCP-10 antibody, PRED77 antibody, TCP 10
Cross Reactivity Human
Applications IHC, WB
Immunogen TCP10L antibody was raised using a synthetic peptide corresponding to a region with amino acids ASPHAGQESHTLALEPAFGKISPLSADEETIPKYAGHKNQSATLLGQRSS
Assay Information TCP10L Blocking Peptide, catalog no. 33R-1520, is also available for use as a blocking control in assays to test for specificity of this TCP10L antibody


Immunohistochemical staining using TCP10L antibody (70R-1022)

TCP10L antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TCP10L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TCP10L is a human leucine zipper protein with transcription inhibition activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using TCP10L antibody (70R-1022) | TCP10L antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X
  • Western Blot analysis using TCP10L antibody (70R-1022) | TCP10L antibody (70R-1022) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors