TCP11 antibody (70R-3950)

Rabbit polyclonal TCP11 antibody

Synonyms Polyclonal TCP11 antibody, Anti-TCP11 antibody, KIAA0229 antibody, TCP11, TCP 11 antibody, TCP-11, TCP-11 antibody, MGC111103 antibody, T-Complex 11 Homolog antibody, D6S230E antibody, TCP 11
Cross Reactivity Human, Mouse
Applications WB
Immunogen TCP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids CVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNL
Assay Information TCP11 Blocking Peptide, catalog no. 33R-1827, is also available for use as a blocking control in assays to test for specificity of this TCP11 antibody

Images

Western Blot analysis using TCP11 antibody (70R-3950)

TCP11 antibody (70R-3950) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TCP11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TCP11 may play an important role in sperm function and fertility.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TCP11 antibody (70R-3950) | TCP11 antibody (70R-3950) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors