TCTE1 antibody (70R-3599)

Rabbit polyclonal TCTE1 antibody raised against the middle region of TCTE1

Synonyms Polyclonal TCTE1 antibody, Anti-TCTE1 antibody, MGC33600 antibody, T-Complex-Associated-Testis-Expressed 1 antibody, D6S46 antibody
Specificity TCTE1 antibody was raised against the middle region of TCTE1
Cross Reactivity Human,Mouse
Applications WB
Immunogen TCTE1 antibody was raised using the middle region of TCTE1 corresponding to a region with amino acids MNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIIIRSL
Assay Information TCTE1 Blocking Peptide, catalog no. 33R-6244, is also available for use as a blocking control in assays to test for specificity of this TCTE1 antibody


Western Blot analysis using TCTE1 antibody (70R-3599)

TCTE1 antibody (70R-3599) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TCTE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TCTE1 contains 7 LRR (leucine-rich) repeats. The exact function of TCTE1 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TCTE1 antibody (70R-3599) | TCTE1 antibody (70R-3599) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors