TDRD9 antibody (70R-4621)

Rabbit polyclonal TDRD9 antibody raised against the middle region of TDRD9

Synonyms Polyclonal TDRD9 antibody, Anti-TDRD9 antibody, DKFZp434N0820 antibody, TDRD-9, C14orf75 antibody, Tudor Domain Containing 9 antibody, FLJ36164 antibody, TDRD9, MGC135025 antibody, TDRD 9, TDRD-9 antibody, HIG-1 antibody, TDRD 9 antibody
Specificity TDRD9 antibody was raised against the middle region of TDRD9
Cross Reactivity Human
Applications WB
Immunogen TDRD9 antibody was raised using the middle region of TDRD9 corresponding to a region with amino acids AINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPM
Assay Information TDRD9 Blocking Peptide, catalog no. 33R-1276, is also available for use as a blocking control in assays to test for specificity of this TDRD9 antibody


Western blot analysis using TDRD9 antibody (70R-4621)

Recommended TDRD9 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 103 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TDRD9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TDRD9 contains 1 helicase ATP-binding domain and 1 helicase C-terminal domain. The exact function of TDRD9 is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using TDRD9 antibody (70R-4621) | Recommended TDRD9 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors