Tetraspanin 1 antibody (70R-2230)

Rabbit polyclonal Tetraspanin 1 antibody raised against the middle region of TSPAN1

Synonyms Polyclonal Tetraspanin 1 antibody, Anti-Tetraspanin 1 antibody, RP11-322N21.1 antibody, Tetraspanin 1, 9030418M05Rik antibody, Tetraspanin -1 antibody, TSPAN1 antibody, TSPAN-1 antibody, Tetraspanin 1 antibody, Tetraspanin -1, NET-1 antibody, Tetraspanin 1
Specificity Tetraspanin 1 antibody was raised against the middle region of TSPAN1
Cross Reactivity Human
Applications WB
Immunogen Tetraspanin 1 antibody was raised using the middle region of TSPAN1 corresponding to a region with amino acids TMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKA
Assay Information Tetraspanin 1 Blocking Peptide, catalog no. 33R-9202, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 1 antibody


Western Blot analysis using Tetraspanin 1 antibody (70R-2230)

Tetraspanin 1 antibody (70R-2230) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSPAN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Tetraspanin 1 antibody (70R-2230) | Tetraspanin 1 antibody (70R-2230) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors