Tetraspanin 32 antibody (70R-1910)

Rabbit polyclonal Tetraspanin 32 antibody raised against the middle region of TSPAN32

Synonyms Polyclonal Tetraspanin 32 antibody, Anti-Tetraspanin 32 antibody, Tetraspanin 32, TSSC6 antibody, PHMX antibody, TSPAN32 antibody, Tetraspanin -32, Tetraspanin 32 antibody, Tetraspanin 32, PHEMX antibody, MGC22455 antibody, Tetraspanin -32 antibody
Specificity Tetraspanin 32 antibody was raised against the middle region of TSPAN32
Cross Reactivity Human
Applications IHC, WB
Immunogen Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR
Assay Information Tetraspanin 32 Blocking Peptide, catalog no. 33R-10089, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 32 antibody


Immunohistochemical staining using Tetraspanin 32 antibody (70R-1910)

Tetraspanin 32 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TSPAN32 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as hematopoietic cell function.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using Tetraspanin 32 antibody (70R-1910) | Tetraspanin 32 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X
  • Western Blot analysis using Tetraspanin 32 antibody (70R-1910) | Tetraspanin 32 antibody (70R-1910) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors