TFAM antibody (70R-1944)

Rabbit polyclonal TFAM antibody raised against the middle region of TFAM

Synonyms Polyclonal TFAM antibody, Anti-TFAM antibody, mtTFA antibody, Hmgts antibody, tsHMG antibody, Transcription Factor A Mitochondrial antibody, AI661103 antibody
Specificity TFAM antibody was raised against the middle region of TFAM
Cross Reactivity Human
Applications WB
Immunogen TFAM antibody was raised using the middle region of TFAM corresponding to a region with amino acids LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI
Assay Information TFAM Blocking Peptide, catalog no. 33R-4981, is also available for use as a blocking control in assays to test for specificity of this TFAM antibody

Images

Western blot analysis using TFAM antibody (70R-1944)

Recommended Tfam Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TFAM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TFAM is a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using TFAM antibody (70R-1944) | Recommended Tfam Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors