TFPI2 antibody (70R-5383)

Rabbit polyclonal TFPI2 antibody raised against the middle region of TFPI2

Synonyms Polyclonal TFPI2 antibody, Anti-TFPI2 antibody, FLJ21164 antibody, PP5 antibody, TFPI 2 antibody, TFPI-2 antibody, TFPI 2, TFPI-2, TFPI2, TFPI-2 antibody, Tissue Factor Pathway Inhibitor 2 antibody
Specificity TFPI2 antibody was raised against the middle region of TFPI2
Cross Reactivity Human
Applications WB
Immunogen TFPI2 antibody was raised using the middle region of TFPI2 corresponding to a region with amino acids NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT
Assay Information TFPI2 Blocking Peptide, catalog no. 33R-6642, is also available for use as a blocking control in assays to test for specificity of this TFPI2 antibody


Western Blot analysis using TFPI2 antibody (70R-5383)

TFPI2 antibody (70R-5383) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TFPI2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TFPI2 antibody (70R-5383) | TFPI2 antibody (70R-5383) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors