TGDS antibody (70R-4004)

Rabbit polyclonal TGDS antibody raised against the middle region of TGDS

Synonyms Polyclonal TGDS antibody, Anti-TGDS antibody, TDPGD antibody, Tdp-Glucose 46-Dehydratase antibody
Specificity TGDS antibody was raised against the middle region of TGDS
Cross Reactivity Human
Applications WB
Immunogen TGDS antibody was raised using the middle region of TGDS corresponding to a region with amino acids DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR
Assay Information TGDS Blocking Peptide, catalog no. 33R-1924, is also available for use as a blocking control in assays to test for specificity of this TGDS antibody


Western Blot analysis using TGDS antibody (70R-4004)

TGDS antibody (70R-4004) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TGDS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TGDS protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TGDS antibody (70R-4004) | TGDS antibody (70R-4004) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors