TGFBR2 antibody (70R-1848)

Rabbit polyclonal TGFBR2 antibody

Synonyms Polyclonal TGFBR2 antibody, Anti-TGFBR2 antibody, Transforming Growth Factor Beta Receptor Ii antibody, MFS2 antibody, Tbeta antibody, HNPCC6 antibody, RIIC antibody, TGF beta R2 antibody
Cross Reactivity Human
Applications WB
Immunogen TGFBR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT
Assay Information TGFBR2 Blocking Peptide, catalog no. 33R-6065, is also available for use as a blocking control in assays to test for specificity of this TGFBR2 antibody


Western Blot analysis using TGFBR2 antibody (70R-1848)

TGFBR2 antibody (70R-1848) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TGFBR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TGFBR2 is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in its gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TGFBR2 antibody (70R-1848) | TGFBR2 antibody (70R-1848) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors