TGIF1 antibody (70R-2282)

Rabbit polyclonal TGIF1 antibody raised against the C terminal of TGIF1

Synonyms Polyclonal TGIF1 antibody, Anti-TGIF1 antibody, Tgfb-Induced Factor Homeobox 1 antibody, TGIF 1 antibody, TGIF antibody, TGIF 1, TGIF1, MGC5066 antibody, TGIF-1 antibody, HPE4 antibody, MGC39747 antibody, TGIF-1
Specificity TGIF1 antibody was raised against the C terminal of TGIF1
Cross Reactivity Human
Applications WB
Immunogen TGIF1 antibody was raised using the C terminal of TGIF1 corresponding to a region with amino acids GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN
Assay Information TGIF1 Blocking Peptide, catalog no. 33R-3506, is also available for use as a blocking control in assays to test for specificity of this TGIF1 antibody

Images

Western Blot analysis using TGIF1 antibody (70R-2282)

TGIF1 antibody (70R-2282) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TGIF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TGIF1 is a member of the three-amino acid loop extension (TALE) superclass of atypical homeodomains. TALE homeobox proteins are highly conserved transcription regulators. This particular homeodomain binds to a previously characterized retinoid X receptor responsive element from the cellular retinol-binding protein II promoter. In addition to its role in inhibiting 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element, the protein is an active transcriptional co-repressor of SMAD2 and may participate in the transmission of nuclear signals during development and in the adult. Mutations in this gene are associated with holoprosencephaly type 4, which is a structural anomaly of the brain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TGIF1 antibody (70R-2282) | TGIF1 antibody (70R-2282) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors