TGS1 antibody (70R-2563)

Rabbit polyclonal TGS1 antibody

Synonyms Polyclonal TGS1 antibody, Anti-TGS1 antibody, Trimethylguanosine Synthase Homolog antibody, TGS 1, PIMT antibody, FLJ22995 antibody, NCOA6IP antibody, TGS 1 antibody, PIPMT antibody, TGS1, TGS-1 antibody, TGS-1, DKFZp762A163 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen TGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY
Assay Information TGS1 Blocking Peptide, catalog no. 33R-3910, is also available for use as a blocking control in assays to test for specificity of this TGS1 antibody


Western Blot analysis using TGS1 antibody (70R-2563)

TGS1 antibody (70R-2563) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 96 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TGS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TGS1 catalyzes the methylation step(s) for the conversion of the 7-monomethylguanosine (m7G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. TGS1 plays a role in transcriptional regulation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TGS1 antibody (70R-2563) | TGS1 antibody (70R-2563) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors