THOC1 antibody (70R-4764)

Rabbit polyclonal THOC1 antibody raised against the C terminal of THOC1

Synonyms Polyclonal THOC1 antibody, Anti-THOC1 antibody, THOC1, THOC 1 antibody, HPR1 antibody, P84N5 antibody, P84 antibody, Tho Complex 1 antibody, THOC 1, THOC-1, THOC-1 antibody
Specificity THOC1 antibody was raised against the C terminal of THOC1
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen THOC1 antibody was raised using the C terminal of THOC1 corresponding to a region with amino acids TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES
Assay Information THOC1 Blocking Peptide, catalog no. 33R-9212, is also available for use as a blocking control in assays to test for specificity of this THOC1 antibody


Immunohistochemical staining using THOC1 antibody (70R-4764)

THOC1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of THOC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance THOC1 is part of the TREX (transcription/export) complex, which includes TEX1, THO2, ALY, and UAP56.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using THOC1 antibody (70R-4764) | THOC1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X.
  • Western Blot analysis using THOC1 antibody (70R-4764) | THOC1 antibody (70R-4764) used at 0.25 ug/ml to detect target protein.
  • Immunohistochemical staining using THOC1 antibody (70R-4764) | THOC1 antibody was used for immunohistochemistry at a concentration of 0.1 ug/ml to stain Crypt-Villus Axis Antibody  in Murine Small Intestine. Magnification is at 40X

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors