THOC3 antibody (70R-1456)

Rabbit polyclonal THOC3 antibody raised against the middle region of THOC3

Synonyms Polyclonal THOC3 antibody, Anti-THOC3 antibody, MGC5469 antibody, THOC3, Tho Complex 3 antibody, THOC 3 antibody, THOC-3, THOC 3, THOC-3 antibody, TEX1 antibody
Specificity THOC3 antibody was raised against the middle region of THOC3
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen THOC3 antibody was raised using the middle region of THOC3 corresponding to a region with amino acids PDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLT
Assay Information THOC3 Blocking Peptide, catalog no. 33R-7013, is also available for use as a blocking control in assays to test for specificity of this THOC3 antibody


Immunohistochemical staining using THOC3 antibody (70R-1456)

THOC3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of THOC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance THOC3 is part of the TREX (transcription/export) complex, which includes THO2, HPR1, ALY, and UAP56.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using THOC3 antibody (70R-1456) | THOC3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X.
  • Western Blot analysis using THOC3 antibody (70R-1456) | THOC3 antibody (70R-1456) used at 0.25 ug/ml to detect target protein.
  • Immunohistochemical staining using THOC3 antibody (70R-1456) | THOC3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors