THOC4 antibody (70R-1327)

Rabbit polyclonal THOC4 antibody raised against the N terminal of THOC4

Synonyms Polyclonal THOC4 antibody, Anti-THOC4 antibody, THOC-4 antibody, THOC-4, THOC 4, ALY antibody, Tho Complex 4 antibody, THOC 4 antibody, BEF antibody, THOC4
Specificity THOC4 antibody was raised against the N terminal of THOC4
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen THOC4 antibody was raised using the N terminal of THOC4 corresponding to a region with amino acids GGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGA
Assay Information THOC4 Blocking Peptide, catalog no. 33R-3282, is also available for use as a blocking control in assays to test for specificity of this THOC4 antibody


Immunohistochemical staining using THOC4 antibody (70R-1327)

THOC4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of THOC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance THOC4 is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using THOC4 antibody (70R-1327) | THOC4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using THOC4 antibody (70R-1327) | THOC4 antibody (70R-1327) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors