THYN1 antibody (70R-4037)

Rabbit polyclonal THYN1 antibody raised against the N terminal of THYN1

Synonyms Polyclonal THYN1 antibody, Anti-THYN1 antibody, THY28KD antibody, THYN 1 antibody, MY105 antibody, Thymocyte Nuclear Protein 1 antibody, MGC12187 antibody, HSPC144 antibody, THYN1, MDS012 antibody, THYN-1, THY28 antibody, THYN 1, THYN-1 antibody
Specificity THYN1 antibody was raised against the N terminal of THYN1
Cross Reactivity Human
Applications WB
Immunogen THYN1 antibody was raised using the N terminal of THYN1 corresponding to a region with amino acids MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCL
Assay Information THYN1 Blocking Peptide, catalog no. 33R-6487, is also available for use as a blocking control in assays to test for specificity of this THYN1 antibody

Images

Western Blot analysis using THYN1 antibody (70R-4037)

THYN1 antibody (70R-4037) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of THYN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using THYN1 antibody (70R-4037) | THYN1 antibody (70R-4037) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors