TIGD3 antibody (70R-1209)

Rabbit polyclonal TIGD3 antibody raised against the N terminal of TIGD3

Synonyms Polyclonal TIGD3 antibody, Anti-TIGD3 antibody, TIGD-3, Tigger Transposable Element Derived 3 antibody, TIGD 3, TIGD-3 antibody, TIGD 3 antibody, TIGD3
Specificity TIGD3 antibody was raised against the N terminal of TIGD3
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen TIGD3 antibody was raised using the N terminal of TIGD3 corresponding to a region with amino acids NKEKLLADWCSGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGP
Assay Information TIGD3 Blocking Peptide, catalog no. 33R-6738, is also available for use as a blocking control in assays to test for specificity of this TIGD3 antibody


Western Blot analysis using TIGD3 antibody (70R-1209)

TIGD3 antibody (70R-1209) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TIGD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TIGD3 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of TIGD3 gene is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TIGD3 antibody (70R-1209) | TIGD3 antibody (70R-1209) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors