TM9SF1 antibody (70R-1883)

Rabbit polyclonal TM9SF1 antibody raised against the N terminal of TM9SF1

Synonyms Polyclonal TM9SF1 antibody, Anti-TM9SF1 antibody, TMSF1-9, TM9SF1, TMSF1-9 antibody, Transmembrane 9 Superfamily Member 1 antibody, MP70 antibody, TMSF1 9 antibody, TMSF1 9, HMP70 antibody
Specificity TM9SF1 antibody was raised against the N terminal of TM9SF1
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications IHC, WB
Immunogen TM9SF1 antibody was raised using the N terminal of TM9SF1 corresponding to a region with amino acids EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG
Assay Information TM9SF1 Blocking Peptide, catalog no. 33R-2450, is also available for use as a blocking control in assays to test for specificity of this TM9SF1 antibody


Immunohistochemical staining using TM9SF1 antibody (70R-1883)

TM9SF1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TM9SF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TM9SF1 may function as channel, small molecule transporter or receptor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using TM9SF1 antibody (70R-1883) | TM9SF1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using TM9SF1 antibody (70R-1883) | TM9SF1 antibody (70R-1883) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors