TM9SF1 antibody (70R-1890)

Rabbit polyclonal TM9SF1 antibody raised against the middle region of TM9SF1

Synonyms Polyclonal TM9SF1 antibody, Anti-TM9SF1 antibody, Transmembrane 9 Superfamily Member 1 antibody, TMSF1-9, TMSF1 9 antibody, MP70 antibody, TM9SF1, TMSF1 9, TMSF1-9 antibody, HMP70 antibody
Specificity TM9SF1 antibody was raised against the middle region of TM9SF1
Cross Reactivity Human,Mouse,Dog
Applications IHC, WB
Immunogen TM9SF1 antibody was raised using the middle region of TM9SF1 corresponding to a region with amino acids THTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLV
Assay Information TM9SF1 Blocking Peptide, catalog no. 33R-9110, is also available for use as a blocking control in assays to test for specificity of this TM9SF1 antibody


Immunohistochemical staining using TM9SF1 antibody (70R-1890)

TM9SF1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TM9SF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TM9SF1 may function as channel, small molecule transporter or receptor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using TM9SF1 antibody (70R-1890) | TM9SF1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using TM9SF1 antibody (70R-1890) | TM9SF1 antibody (70R-1890) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors