TMCO6 antibody (70R-3902)

Rabbit polyclonal TMCO6 antibody raised against the N terminal of TMCO6

Synonyms Polyclonal TMCO6 antibody, Anti-TMCO6 antibody, TMCO-6 antibody, FLJ39769 antibody, Transmembrane And Coiled-Coil Domains 6 antibody, TMCO6, TMCO-6, TMCO 6 antibody, PRO1580 antibody, TMCO 6
Specificity TMCO6 antibody was raised against the N terminal of TMCO6
Cross Reactivity Human
Applications WB
Immunogen TMCO6 antibody was raised using the N terminal of TMCO6 corresponding to a region with amino acids LRQAQRGTEEKEREGALVSLRRGLQHPETQQTFIRLEGSMRTLVGLLTSN
Assay Information TMCO6 Blocking Peptide, catalog no. 33R-5380, is also available for use as a blocking control in assays to test for specificity of this TMCO6 antibody


Western Blot analysis using TMCO6 antibody (70R-3902)

TMCO6 antibody (70R-3902) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMCO6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TMCO6 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TMCO6 antibody (70R-3902) | TMCO6 antibody (70R-3902) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors