TMED3 antibody (70R-1897)

Rabbit polyclonal TMED3 antibody raised against the C terminal of TMED3

Synonyms Polyclonal TMED3 antibody, Anti-TMED3 antibody, C15orf22 antibody, P24B antibody, MGC133022 antibody, TMED3, TMED 3, TMED-3 antibody, Transmembrane Emp24 Protein Transport Domain Containing 3 antibody, TMED 3 antibody, TMED-3
Specificity TMED3 antibody was raised against the C terminal of TMED3
Cross Reactivity Human
Applications WB
Immunogen TMED3 antibody was raised using the C terminal of TMED3 corresponding to a region with amino acids DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS
Assay Information TMED3 Blocking Peptide, catalog no. 33R-2139, is also available for use as a blocking control in assays to test for specificity of this TMED3 antibody

Images

Western Blot analysis using TMED3 antibody (70R-1897)

TMED3 antibody (70R-1897) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TMED3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of this gene remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMED3 antibody (70R-1897) | TMED3 antibody (70R-1897) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors