TMED8 antibody (70R-4289)

Rabbit polyclonal TMED8 antibody raised against the middle region of TMED8

Synonyms Polyclonal TMED8 antibody, Anti-TMED8 antibody, FAM15B antibody, TMED 8 antibody, MGC126559 antibody, Transmembrane Emp24 Protein Transport Domain Containing 8 antibody, TMED-8 antibody, TMED8, TMED 8, TMED-8
Specificity TMED8 antibody was raised against the middle region of TMED8
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMED8 antibody was raised using the middle region of TMED8 corresponding to a region with amino acids EVMPVYRRDSHRDVQAGSHDYPGEGIYLLKFDNSYSLLRNKTLYFHIYYT
Assay Information TMED8 Blocking Peptide, catalog no. 33R-2803, is also available for use as a blocking control in assays to test for specificity of this TMED8 antibody

Images

Western Blot analysis using TMED8 antibody (70R-4289)

TMED8 antibody (70R-4289) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMED8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TMED8 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMED8 antibody (70R-4289) | TMED8 antibody (70R-4289) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors