TMEM104 antibody (70R-1724)

Rabbit polyclonal TMEM104 antibody raised against the middle region of TMEM104

Synonyms Polyclonal TMEM104 antibody, Anti-TMEM104 antibody, TMEM 104 antibody, TMEM 104, Transmembrane Protein 104 antibody, FLJ00021 antibody, FLJ20255 antibody, TMEM-104, TMEM-104 antibody, TMEM104
Specificity TMEM104 antibody was raised against the middle region of TMEM104
Cross Reactivity Human
Applications WB
Immunogen TMEM104 antibody was raised using the middle region of TMEM104 corresponding to a region with amino acids GDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCWGPLRRVDA
Assay Information TMEM104 Blocking Peptide, catalog no. 33R-3200, is also available for use as a blocking control in assays to test for specificity of this TMEM104 antibody


Western Blot analysis using TMEM104 antibody (70R-1724)

TMEM104 antibody (70R-1724) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TMEM104 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TMEM104 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TMEM104 antibody (70R-1724) | TMEM104 antibody (70R-1724) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors