TMEM108 antibody (70R-1305)

Rabbit polyclonal TMEM108 antibody raised against the middle region of TMEM108

Synonyms Polyclonal TMEM108 antibody, Anti-TMEM108 antibody, TMEM 108, TMEM 108 antibody, TMEM-108, Transmembrane Protein 108 antibody, TMEM108, TMEM-108 antibody
Specificity TMEM108 antibody was raised against the middle region of TMEM108
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen TMEM108 antibody was raised using the middle region of TMEM108 corresponding to a region with amino acids NRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI
Assay Information TMEM108 Blocking Peptide, catalog no. 33R-6859, is also available for use as a blocking control in assays to test for specificity of this TMEM108 antibody


Western Blot analysis using TMEM108 antibody (70R-1305)

TMEM108 antibody (70R-1305) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TMEM108 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM108's function has not been determined yet.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TMEM108 antibody (70R-1305) | TMEM108 antibody (70R-1305) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors