TMEM139 antibody (70R-4551)

Rabbit polyclonal TMEM139 antibody raised against the N terminal of TMEM139

Synonyms Polyclonal TMEM139 antibody, Anti-TMEM139 antibody, TMEM139, TMEM 139, TMEM-139 antibody, TMEM-139, Transmembrane Protein 139 antibody, TMEM 139 antibody, FLJ90586 antibody
Specificity TMEM139 antibody was raised against the N terminal of TMEM139
Cross Reactivity Human
Applications WB
Immunogen TMEM139 antibody was raised using the N terminal of TMEM139 corresponding to a region with amino acids ITPVAYFFLTLGGFFLFAYLLVRFLEWGLRSQLQSMQTESPGPSGNARDN
Assay Information TMEM139 Blocking Peptide, catalog no. 33R-4186, is also available for use as a blocking control in assays to test for specificity of this TMEM139 antibody


Western Blot analysis using TMEM139 antibody (70R-4551)

TMEM139 antibody (70R-4551) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM139 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TMEM139 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TMEM139 antibody (70R-4551) | TMEM139 antibody (70R-4551) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors