TMLHE antibody (70R-2479)

Rabbit polyclonal TMLHE antibody raised against the middle region of TMLHE

Synonyms Polyclonal TMLHE antibody, Anti-TMLHE antibody, BBOX2 antibody, FLJ10727 antibody, XAP130 antibody, Trimethyllysine Hydroxylase Epsilon antibody, TMLH antibody
Specificity TMLHE antibody was raised against the middle region of TMLHE
Cross Reactivity Human
Applications WB
Immunogen TMLHE antibody was raised using the middle region of TMLHE corresponding to a region with amino acids PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV
Assay Information TMLHE Blocking Peptide, catalog no. 33R-7434, is also available for use as a blocking control in assays to test for specificity of this TMLHE antibody


Western Blot analysis using TMLHE antibody (70R-2479)

TMLHE antibody (70R-2479) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMLHE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes the protein trimethyllysine dioxygenase which is the first enzyme in the carnitine biosynthesis pathway. Carnitine play an essential role in the transport of activated fatty acids across the inner mitochondrial membrane.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TMLHE antibody (70R-2479) | TMLHE antibody (70R-2479) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors