TNFAIP8L1 antibody (70R-3644)

Rabbit polyclonal TNFAIP8L1 antibody raised against the middle region of TNFAIP8L1

Synonyms Polyclonal TNFAIP8L1 antibody, Anti-TNFAIP8L1 antibody, MGC17791 antibody, Tumor Necrosis Factor Alpha-Induced Protein 8-Like 1 antibody
Specificity TNFAIP8L1 antibody was raised against the middle region of TNFAIP8L1
Cross Reactivity Human
Applications WB
Immunogen TNFAIP8L1 antibody was raised using the middle region of TNFAIP8L1 corresponding to a region with amino acids AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL
Assay Information TNFAIP8L1 Blocking Peptide, catalog no. 33R-1311, is also available for use as a blocking control in assays to test for specificity of this TNFAIP8L1 antibody


Western Blot analysis using TNFAIP8L1 antibody (70R-3644)

TNFAIP8L1 antibody (70R-3644) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TNFAIP8L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TNFAIP8L1 belongs to the TNFAIP8 family. The exact function of TNFAIP8L is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TNFAIP8L1 antibody (70R-3644) | TNFAIP8L1 antibody (70R-3644) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors